PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009796922.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 258aa    MW: 30338.7 Da    PI: 10.4465
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009796922.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF466.7e-15851649
                    HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    ++  +v +  R ++++KKAeELS+LC++e+ +++fs++ k  ey
  XP_009796922.1  8 ERGSSVVLQERMETLFKKAEELSILCGVEIGIVVFSPHKKNAEY 51
                    566789999***************************98776555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.783155IPR002100Transcription factor, MADS-box
SMARTSM004326.4E-5154IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-15790IPR002100Transcription factor, MADS-box
PfamPF003191.7E-13748IPR002100Transcription factor, MADS-box
CDDcd001207.18E-13755No hitNo description
PRINTSPR004041.7E-51732IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-53253IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MARKNINERG SSVVLQERME TLFKKAEELS ILCGVEIGIV VFSPHKKNAE YEWPSRDKFK  60
QLLMRFLDKP LVERLKKLTT HEEFLRKEIE KNVRKIDPQK TEEKEMEQLF KQLYHGKKTV  120
FELDRRQLIG VRNLAIKAKE KAVERRIRLQ LQDQRLWLPI DHVPFLVASL NVPDQRLQLP  180
IDPIPLRVAP LNVHDQRQIL QLPIDHVPLR VATLNVQDQR LHLPIDDPLA LRLAPPNVQY  240
QRLQLPIVDP LKLRLAPP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009796922.10.0PREDICTED: agamous-like MADS-box protein AGL80
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37820129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.24e-14M-type_MADS family protein